Activities | Families | Sequences | Fold types | References | Help
B6db sequences: zp.00093940.1

ZP_00093940.1

Description hypothetical protein [Novosphingobium aromaticivorans]
Activity 2.6.1.52
Family 2.6.1.52
Evidence ISS - similarity
Phylum Bacteria
OS Novosphingobium aromaticivorans
GB ZP_00093940.1
SQ
MGRVERALRKHRLTYPAAPLERPAGHAVPTPRVLSARRDYMSATIPARKPARPFFSSGPC
AKPPGYSPEKLATESLGRSHRAKIGKTRLQYCIDLMREVLQLPDTHRIGIVPGSDTGAFE
MAMWTMLGARPVTTLAWESFGEGWVTDAAKQLKLDPTVLRADYGQIPDLNAIDWSNDVLF
TWNGTTSGVRVPNADFIPADREGLAFADATSAVFAYDIDWSKIDVATFSWQKVLGGEGGH
GVLILGPRAVERLETYTPAWPLPKVFRLVSKGKLAEGVFKGETINTPSMLAVEDAIFALE
WAKGLGGLEGLQARSDANAAALNKIVEERSWLSHLAADEATRSKTSVCLSVEGADADFIK
KFAGLLEKQGAAYDIAGYRDAPAGLRIWCGATVNAEDIADLGPWLDWAYETTRAELAAA
 
last changed 2005/03/16 20:04

B6db sequences