Activities | Families | Sequences | Fold types | References | Help
B6db sequences: zp.00098434.1

ZP_00098434.1

Description hypothetical protein [Desulfitobacterium hafniense]
Activity 4.1.99.1
Family 4.1.99.1
Evidence ISS - similarity
Phylum Bacteria
OS Desulfitobacterium hafniense
GB ZP_00098434.1
SQ
MEVFVMAIKYVPEPFRIKVVEPLRMLTQEEREEKIAKANYNLFNLKGEDCYIDLLTDSGT
NAMSQEQWAGVMRGDEAYAGASSYFKLMEAGKDIFGFGYIQPVHQGRAAEKVVFPLLLSE
GKFAISNMFFDTTRAHVILSGARPIDCVVEEAKDPSKRAPFKGNMDVAKMEEVIKEKGPE
NIGLVVMTITNNSAGGQPVSMKNLREVSALAKKYGIPMCIDAARYAENAHFIKRDEPEYK
DVSIKDIVREMFSYGELFTMSAKKDTIVNMGGLLGVKDADSPLVLKIKANCISYEGFFTY
GGLSGRDMEALAIGLYEGIDENYLRYRIGQMEYLAARLDDAGIAYQSPVGGHGVFVDAAA
MFPHIPYNEFPGQVLCVELYKEAGIRTCDIGSYMLGNDPDTGEQLKADFEFSRLAIPRRV
YTQAHLDIMADALIAIKERAHTIKRGYKITWEPPILRHFQASLAPIE
 
last changed 2005/03/16 20:05

B6db sequences