Activities | Families | Sequences | Fold types | References | Help
B6db sequences: zp.00098586.1

ZP_00098586.1

Description hypothetical protein
Activity 4.3.1.15
Family 4.3.1.15
Evidence ISS - similarity
Phylum Bacteria
OS Desulfitobacterium hafniense
GB ZP_00098586.1
SQ
MKGGSLVKEEIKIISFQRDKQKASDLTFLNLEEAEKVHSFHVSFPIYQKTPLRELKNTAQ
ALGLGTVYVKDESYRFGLNAFKVLGGSYAIGNYIASKLGTDIRDLPYEKMVSEEVRSKLG
ELTFVTATDGNHGRGVAWTANQLKQRSVVYMPKGSAPERLENIRAEGAEASITELNYDEA
VRLANRKAEENGWIMVQDTAWQGYEDIPRWIMQGYGTLGYEVYGQLKEKPTHIFLQAGVG
SMAGAVTGFFASLYGEERPIIAIVEPNKADCLYLTAQADDGERHFVTGEMNTIMAGLACG
EPCSIAWEVLKDYADHFISCPDYVAAKGMRILGNPVQGDERVISGESGAAPFGCVAEIMT
NPLYKEIKDQLQLNENSRVLFFSTEGDTDQENYQAIVWDGKYPSCK
 
last changed 2005/03/16 20:04

B6db sequences