Activities | Families | Sequences | Fold types | References | Help
B6db sequences: zp.00108499.1

ZP_00108499.1

Description hypothetical protein [Nostoc punctiforme]
Activity 2.8.1.7
Family 2.8.1.7.a
Evidence ISS - similarity
Phylum Bacteria
OS Nostoc punctiforme
GB ZP_00108499.1
SQ
MSIRPIYLDCHATTPVDERVLAAMIPYFTEKFGNASSIGHVYGWESEAAVKQTREILAAA
INATPEEIVFTSGATEANNLAIKGVAEAYFKKGQHIITVATEHNAVLDPCNYLKTLGFEI
TILPVKKDGLIDLTELNKAFRPETILVSVMAANNEIGVLQPLAEIGELCHAYNIIFHTDA
AQAIGKTPLDVQAMKIDLMSLTAHKVFGPKGIGALYVRRRDPRVQLAPQQHGGGHERGMR
SGTLYTPQIVGFGKAVEIALAEQATENQRLTQLRQSLWKQLSQLEGIHLNGHPQQRLAGN
LNISVEGVDGAALLLGLQPVMSVSSGSACSSANTSPSSVLTALGNPQQLAYASVRFGIGR
FNTQEEIDIVAKHAIATIQSLRKPSFMDSRAGKQQFDLAPAD
 
last changed 2005/03/16 20:05

B6db sequences