Activities | Families | Sequences | Fold types | References | Help
B6db sequences: zp.00115395

ZP_00115395

Description hypothetical protein [Synechococcus sp. WH 8102]
Activity 2.6.1.51
Family 2.6.1.51
Evidence ISS - similarity
Phylum Bacteria
OS Synechococcus sp. WH 8102
GB ZP_00115395
SQ
MTNSLLPVKDAHRQAFNAINTPDRLLLGPGPSNAHPTVLEALSRTPIGHLDPLYVELMGE
VQELLRYAWQTDNRLTLPMSGTGSAAMEATLANTVEPGDTVLVAVKGYFGLRLADMAGRY
RATVKTIEKPWGEWFSLEELEAALIEHKPAILALVHAETSTGVCQPMDGVGDLCRKHDCL
LLLDTVTSLGGVPLYIDEWKVDLAYSCSQKGLSCPPGLGPFTMGPRAEAKMATRSGKVPN
WYLDVSLLNQYWGSDRVYHHTAPVNMNFGMREALRLLAEEGLDQAWARHRRNAERLWSGL
ERQGLSMHVPEELRLPTLTTVRIPDGVDGKAFSQHLLNTHGIEVGGGLGSLAGKIWRIGL
MGYNSTPENVDRLLNLFETELPRFSGSVAAAA
 
last changed 2005/03/16 20:04

B6db sequences