Activities | Families | Sequences | Fold types | References | Help
B6db sequences: zp.00117422

ZP_00117422

Description Branched-chain amino acid aminotransferase
Activity 2.6.1.42
Family 2.6.1.42
Evidence ISS - similarity
Phylum Bacteria
OS Cytophaga hutchinsonii
GB ZP_00117422
SQ
MSASKAVNFPIERTQHSRLSETDFSNLEFGTVNSDHMFVVDYKKGEWVDPKIIPFQNISV
SPACSSLHYGQTVFEGMKAFRAPNGDLLVFRPEKHLERMNNSNRRLCIPEIPAEYFYDAI
DALVKLDQDWIPNQEGCSLYLRPFIFANDPFIGVKPSSAYKFMIFTCPVAGYYKGTVKVI
IESDFVRASPGGIGAAKTGGNYAASLLPAKLAADKGYQQILWTDSKEHKYFEESGTMNLM
FVINDVLITPSLDGSILPGITRDTILTIAKDWGVKVEERRVSVEEVITAFNNGTLQDAFG
TGTAATITQIAEIHHNGKDMVLPPVAGRTLSNKLNQTIVDLKNGIGEDKYNWVHRIKK
 
last changed 2005/03/16 20:05

B6db sequences