Activities | Families | Sequences | Fold types | References | Help
B6db sequences: zp.00118864.1

ZP_00118864.1

Description hypothetical protein
Activity 3.7.1.3
Family 3.7.1.3
Evidence ISS - similarity
Phylum Bacteria
OS Cytophaga hutchinsonii
GB ZP_00118864.1
SQ
MPTKFLITRAYSVQLDKEDPLAEFRKEFLFPGPPAAKAYFCGHSLGLQPKRTKELMLHEL
ADWEKWGVEGHWKAANPWLHYHQSFAKPLSVLAGAYPDEVVAMNSLTTNLHFMLASFYRP
AGKKIKIITEAWNFPSDRFALESLVKLYGYDPKKVIIELKPGKKNTALTTEEICASIQKN
KDSLALVVLSGVNYYSGQAFDMERISQATHLAGAFVGFDLAHAIGNIPLHLHDWKVDFAV
WCSYKYLNGGPGAVGGAFVHQKHGHDKTTPRMAGWWGHDHNTRFNLEGTYKPLSGAAGFQ
VSNAPVFNMIGLKASLDIFMQAGLTAINKKRTTMFNYMVFLIHALCTEDQKKAFSIQMIT
PVTQQQHGSMLSIRVEKNKGKQLFDLLSKQGFMLDWREPDVIRIAPVPLYNKYQEIYSFV
LELSKHAVLVRL
 
last changed 2005/03/16 20:05

B6db sequences