Activities | Families | Sequences | Fold types | References | Help
B6db sequences: zp.00125337

ZP_00125337

Description hypothetical protein [Pseudomonas syringae pv. syringae B728a]
Activity 2.6.1.18
Family 2.6.1.18
Evidence ISS - similarity
Phylum Bacteria
OS Pseudomonas syringae pv. syringae B728a
GB ZP_00125337
SQ
MTDRLAPARPAPMNMFEVSDVPVTRQLKLDAHWMPYTANRNFQRDPRMVVAAHGSYLTDD
KGRKIYDALSGLWTCGAGHTRKEIQEAVSRQLGVLDYSPGFQFGHPLSFQLAEQITDLTP
GNLNHVFYTNSGSECADTAVKMVRAYWRLKGQATKTKMIGRARGYHGVNVAGTSLGGVNG
NRKMFGQLMDVDHLPHTLLASNAYSKGMPEAGGIALADEMLKLIELHDASNIAAVIVEPM
SGSAGVIVPPQGYLKRLREICDQHNILLIFDEVITGFGRTGSMFGADSFGVTPDLMCIAK
QITNGAIPMGAVIASSEIYHTFMNQPTPEYAVEFPHGYTYSAHPVACAAGLAALELLQRE
NLVQQAAAVAPHFERALHGIKGAKNVVDIRNYGLAGAIQLAPRDGDAIVRPFEAGMKLWK
AGFYVRFGGDTLQFGPTFNSQAQDLDRLFDAVGETLNLID
 
last changed 2010/01/08 13:08

B6db sequences