Activities | Families | Sequences | Fold types | References | Help
B6db sequences: zp.00151949

ZP_00151949

Description hypothetical protein
Activity 2.6.1.52
Family 2.6.1.52
Evidence ISS - similarity
Phylum Bacteria
OS Dechloromonas aromatica RCB
GB ZP_00151949
SQ
MSRIWNFSAGPAALPEEVLRQAQEELLDWHGAGCSVMEMSHRGKEFMSILEQAEADLREL
MGIPEQYKVLFLQGGATQQFAQIPMNLLAGRSADYIVTGSWSKKAFKEAQRFGNVRCAAT
TESSGFTRLPAADEIRLDPFAAYLHVCTNETIHGVEIPAERIADTGVPLVADMSSHILSR
PVNVEKFGLIYAGAQKNIGPSGLTLVIVHRDLLGMAPLTIPTVMDYAVMAENGSMLNTPP
TYGIYIAGLVFQWLKRQGGLPGIAAVNAEKARILYAAIDDSEGFYTNPVDPDCRSAMNVP
FVLANPELDAAFLAESKAAGLVSLKGHKSVGGMRASIYNAVSLAGVQSLVDFMNDFAQRK
A
 
last changed 2005/03/16 20:05

B6db sequences