Activities | Families | Sequences | Fold types | References | Help
B6db sequences: zp.00243741

ZP_00243741

Description Predicted amino acid aldolase or racemase
Activity 4.1.2.42
Family 4.1.2.42
Evidence ISS - similarity
Phylum Bacteria
OS Rubrivivax gelatinosus
GB ZP_00243741
SQ
MDAFARSHGVRLRPHAKTHKCSAIALHQVARGAVGVCVQKVGEALALAAGGVRDVFVSNE
VIAPTKLARLAALPSDVQLAIAVDSVVGIERLAAAIQASGRQIDVYVEIDAGQGRCGVPA
AEAGALARQVVAHDGLRFAGLQAYHGGAQHLRSVAERETAIRQAVAMATAARAAVTSLSI
DCPLVTGAGSGSFLLEAASGVYGEIQPGSYAFMDADYARNAPLPGSPRFEHALFVRSQVI
ARHAAHAVVDAGHKSHAIDSGLPTVWGRNFEFRNGGDEHGLLHPRGDEPLPAMGDTVWLV
PGHCDPTVNLHEHLVAVRGGLDRGVVEAVWPIDARGRLD
 
last changed 2010/06/07 17:59

B6db sequences