Activities | Families | Sequences | Fold types | References | Help
B6db sequences: zp.00348343

ZP_00348343

Description COG0399: Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis
Activity 2.6.1.33
Family 2.6.1.33
Evidence ISS - similarity
Phylum Bacteria
OS Actinobacillus pleuropneumoniae
GB ZP_00348343
SQ
MQIPFNKPPIVGTELGYMQQAMASGKLSGDGFYSRRCERWLENQFGTAKALLTPSCTAAL
EMAAILIDIQAGDEVIMPSYTFVSTANAFVLRGAKIVFVDIRPDTMNIDETKIEAAITPK
TKAIVPVHYAGIACEMDTIMAIAEKYRLYVIEDAAQAVMSSYKGKALGTIGHFGCYSFHE
TKNYSAGGEGGALLINDDRFIARAEVIREKGTNRSQFFRGETDKYTWRDLGSSFLMSELQ
AAYLYAQLEVAQQIKQTRLAVWQHYFEVLRPFAEQGRLELPTCPPECEQNGHLFYLKWRN
SDERNDFIERLKQHGILAVFHYVPLHSSPAGQRFGSFIGEDRFTTSESERLVRLPLFYNL
QPQESDKIIRVILEFLHQCNH
 
last changed 2007/11/15 14:57

B6db sequences