Activities | Families | Sequences | Fold types | References | Help
B6db sequences: zp.01114029

ZP_01114029

Description purine catabolism protein
Activity pucg
Family pucg
Evidence ISS - similarity
Phylum Bacteria
OS Reinekea sp. MED297
GB ZP_01114029
SQ
MSAPLIGQYDPAMTGFMNETQARYRQVFRTQNAATMLIDGTSRAGIEAVLVSALRPGDRV
LVPIFGRFGHLLAEIAQRAGADVHTIEVPWGEVFEPEQIEAAIRNVQPRMLAIVQGDTST
TMCQPLEELGAICRAHDVFFYTDATASIVGNDLRADDWQLDAVSVGLQKCLGGPSGSAPV
TLSDRLVDWMRQRRKVEAGIRTEAHQDGSEPFIRSNYFDLPMILDYWGEERLNHHTEATT
MLYGASECARLVIEEGLDQAIERHRQHGDAMLAGVQALGLKPFGDLNHKMNNVVGVAIPD
SVDGDTVRAQMLTDFGIEIGTSFGPLHGKIWRIGTMGYNARKSAVLQTLSCLDNCLAVNG
YRGPRGEAVQAALESYAHA
 
last changed 2010/06/17 13:13

B6db sequences