Activities | Families | Sequences | Fold types | References | Help
B6db sequences: zp.03776774

ZP_03776774

Description hypothetical protein SUBVAR_03321
Activity vioa
Family vioa
Evidence ISS - similarity
Phylum Bacteria
OS Subdoligranulum variabile
GB ZP_03776774
SQ
MMDNILVTRSSMPSLEEYIEEIRPIWESHWLTNMGPKHKELQRKLEEYLAVDYVELLTNG
HMALELTLQAMNLQGEVITTPFTFASTTHAIVRNGLEPVFCDIDPVTYTLDASKVEKLIT
DRTCAIMPVHVYGNVCNMEEIERIARKYGLKVIYDAAHTFGETYKGRGIGSFGDASCFSF
HATKVYNTIEGGAVCYHNEELGKRLYELKNFGIHGPEEVDAVGANAKMNEFCAAMGLCNL
RHVDEEIAKRKKVVERYREHLEGVAGLQLNVEQPDVKYNYAYFPVVFDEKVFGASRNEVF
DALAKRGVCARKYFYPLTNTFACFHNKYNADETPVARYVSERVLTLPLYADLALEDVDRI
CHIILKLKA
 
last changed 2009/06/23 14:29

B6db sequences